PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G070600.1.p
Common NamePRUPE_ppa010926mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB
Protein Properties Length: 231aa    MW: 25972.1 Da    PI: 6.404
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G070600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.11e-081965347
                        SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                        +WT  Ed+l+ +a  ++  +   +W++Ia +++ g+t++++ +++ ++
  Prupe.2G070600.1.p 19 PWTRFEDKLFEQALVRFSEDlpdRWERIAGEVP-GKTPEEVLEHYETL 65
                        7*****************99*************.**********9875 PP

2Myb_DNA-binding44.82.9e-14115159347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT++E++l++ + k++G+g+W++I+r +  +Rt+ q+ s+ qky
  Prupe.2G070600.1.p 115 PWTEQEHKLFLIGLKKFGKGDWRSISRNVVVTRTPTQVASHAQKY 159
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.5061569IPR017884SANT domain
SMARTSM007173.4E-71668IPR001005SANT/Myb domain
SuperFamilySSF466891.58E-111874IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-51866IPR009057Homeodomain-like
PfamPF002495.8E-71965IPR001005SANT/Myb domain
CDDcd001671.42E-71966No hitNo description
PROSITE profilePS5129419.517108164IPR017930Myb domain
SuperFamilySSF466891.22E-16110165IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-17111163IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.609.6E-11112158IPR009057Homeodomain-like
SMARTSM007171.1E-10112162IPR001005SANT/Myb domain
CDDcd001675.08E-9115160No hitNo description
PfamPF002494.0E-12115159IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MFQETAPCWS SMAQSASAPW TRFEDKLFEQ ALVRFSEDLP DRWERIAGEV PGKTPEEVLE  60
HYETLVHDVL EIDSGRVELP SYADDSVVGW DTASQISFGS KLNKHGEPER KKGTPWTEQE  120
HKLFLIGLKK FGKGDWRSIS RNVVVTRTPT QVASHAQKYF LRQSSVKKER KRSSIHDITT  180
VESNSVAVPA DRNWIPPPGV PAQQPPLQQP QGHLPDQGGS MGYQDFGYPM *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-171482573RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007211982.11e-172hypothetical protein PRUPE_ppa010926mg
SwissprotQ8S9H71e-59DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM5WIS81e-171M5WIS8_PRUPE; Uncharacterized protein
STRINGGLYMA20G24600.11e-107(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.16e-69MYB family protein